CBFA2T3 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: CBFA2T3 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324761
• Hersteller Artikelnummer: orb324761
• Alternativnummer: BYT-ORB324761-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CBFA2T3
• Konjugation: Unconjugated
• Alternative Synonym: anti ETO2 antibody, anti MTG16 antibody, anti MTGR2 antibody, anti ZMYND4 antibody

Produktbeschreibung

Rabbit polyclonal antibody to CBFA2T3

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 1.0 mg/ml
• Molekulargewicht: 60kDa
• NCBI: 31276
• UniProt: O75107
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: MPASRLRDRAASSASGSTCGSMSQTHPVLESGLLASAGCSAPRGPRKGGP
• Target-Kategorie: CBFA2T3

Bilder

WB Suggested Anti-CBFA2T3 Antibody Titration: 2.5 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate, CBFA2T3 is supported by BioGPS gene expression data to be expressed in Jurkat.