CBFA2T3 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: CBFA2T3 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324761
• Supplier Catalog Number: orb324761
• Alternative Catalog Number: BYT-ORB324761-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CBFA2T3
• Conjugation: Unconjugated
• Alternative Names: anti ETO2 antibody, anti MTG16 antibody, anti MTGR2 antibody, anti ZMYND4 antibody

Product Description

Rabbit polyclonal antibody to CBFA2T3

Product Properties

• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Molecular Weight: 60kDa
• NCBI: 31276
• UniProt: O75107
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: MPASRLRDRAASSASGSTCGSMSQTHPVLESGLLASAGCSAPRGPRKGGP
• Target: CBFA2T3

Images

WB Suggested Anti-CBFA2T3 Antibody Titration: 2.5 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate, CBFA2T3 is supported by BioGPS gene expression data to be expressed in Jurkat.