NFE2L2 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: NFE2L2 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324768
• Hersteller Artikelnummer: orb324768
• Alternativnummer: BYT-ORB324768-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NFE2L2
• Konjugation: Unconjugated
• Alternative Synonym: anti NRF2 antibody

Produktbeschreibung

Rabbit polyclonal antibody to NFE2L2

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 1.0 mg/ml
• Molekulargewicht: 68kDa
• NCBI: 006155
• UniProt: Q16236
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: KEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGN
• Target-Kategorie: NFE2L2

Bilder

WB Suggested Anti-NFE2L2 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:1562500, Positive Control: A172 cell lysate, NFE2L2 is supported by BioGPS gene expression data to be expressed in A172.