NFE2L2 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: NFE2L2 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324768
• Supplier Catalog Number: orb324768
• Alternative Catalog Number: BYT-ORB324768-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NFE2L2
• Conjugation: Unconjugated
• Alternative Names: anti NRF2 antibody

Product Description

Rabbit polyclonal antibody to NFE2L2

Product Properties

• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Molecular Weight: 68kDa
• NCBI: 006155
• UniProt: Q16236
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: KEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGN
• Target: NFE2L2

Images

WB Suggested Anti-NFE2L2 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:1562500, Positive Control: A172 cell lysate, NFE2L2 is supported by BioGPS gene expression data to be expressed in A172.