ECD Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: ECD Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324771
• Hersteller Artikelnummer: orb324771
• Alternativnummer: BYT-ORB324771-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ECD
• Konjugation: Unconjugated
• Alternative Synonym: anti GCR2 antibody, anti HSGT1 antibody

Produktbeschreibung

Rabbit polyclonal antibody to ECD

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 73kDa
• NCBI: 009196
• UniProt: O95905
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: VDVDLNLVSNILESYSSQAGLAGPASNLLQSMGVQLPDNTDHRPTSKPTK
• Target-Kategorie: ECD

Bilder

WB Suggested Anti-ECD Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: ACHN cell lysate, ECD is supported by BioGPS gene expression data to be expressed in ACHN.