ECD Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: ECD Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324771
• Supplier Catalog Number: orb324771
• Alternative Catalog Number: BYT-ORB324771-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ECD
• Conjugation: Unconjugated
• Alternative Names: anti GCR2 antibody, anti HSGT1 antibody

Product Description

Rabbit polyclonal antibody to ECD

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 73kDa
• NCBI: 009196
• UniProt: O95905
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: VDVDLNLVSNILESYSSQAGLAGPASNLLQSMGVQLPDNTDHRPTSKPTK
• Target: ECD

Images

WB Suggested Anti-ECD Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: ACHN cell lysate, ECD is supported by BioGPS gene expression data to be expressed in ACHN.