RLF Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324772
| Artikelname: |
RLF Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324772 |
| Hersteller Artikelnummer: |
orb324772 |
| Alternativnummer: |
BYT-ORB324772-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human RLF |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti MGC142226 antibody, anti ZN-15L antibody, anti ZNF292L antibody |
| Rabbit polyclonal antibody to RLF |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
218kDa |
| NCBI: |
036553 |
| UniProt: |
Q13129 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: AVAGAGDGVETESMVRGHRPVSPAPGASGLRPCLWQLETELREQEVSEVS |
| Target-Kategorie: |
RLF |
![]()
|
WB Suggested Anti-RLF Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: PANC1 cell lysate. |
