RLF Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324772
| Article Name: |
RLF Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324772 |
| Supplier Catalog Number: |
orb324772 |
| Alternative Catalog Number: |
BYT-ORB324772-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human RLF |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti MGC142226 antibody, anti ZN-15L antibody, anti ZNF292L antibody |
| Rabbit polyclonal antibody to RLF |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
218kDa |
| NCBI: |
036553 |
| UniProt: |
Q13129 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: AVAGAGDGVETESMVRGHRPVSPAPGASGLRPCLWQLETELREQEVSEVS |
| Target: |
RLF |
![]()
|
WB Suggested Anti-RLF Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: PANC1 cell lysate. |
