REPIN1 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: REPIN1 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324774
• Hersteller Artikelnummer: orb324774
• Alternativnummer: BYT-ORB324774-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human REPIN1
• Konjugation: Unconjugated
• Alternative Synonym: anti AP4 antibody, anti RIP60 antibody, anti ZNF464 antibody, anti Zfp464 antibody

Produktbeschreibung

Rabbit polyclonal antibody to REPIN1

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 63kDa
• NCBI: 037532
• UniProt: Q9BWE0
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: VSHRRIHTGERPYACPDCDRSFSQKSNLITHRKSHIRDGAFCCAICGQTF
• Target-Kategorie: REPIN1

Bilder

WB Suggested Anti-REPIN1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HT1080 cell lysate, REPIN1 is supported by BioGPS gene expression data to be expressed in HT1080.