REPIN1 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: REPIN1 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324774
• Supplier Catalog Number: orb324774
• Alternative Catalog Number: BYT-ORB324774-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human REPIN1
• Conjugation: Unconjugated
• Alternative Names: anti AP4 antibody, anti RIP60 antibody, anti ZNF464 antibody, anti Zfp464 antibody

Product Description

Rabbit polyclonal antibody to REPIN1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 63kDa
• NCBI: 037532
• UniProt: Q9BWE0
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: VSHRRIHTGERPYACPDCDRSFSQKSNLITHRKSHIRDGAFCCAICGQTF
• Target: REPIN1

Images

WB Suggested Anti-REPIN1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HT1080 cell lysate, REPIN1 is supported by BioGPS gene expression data to be expressed in HT1080.