Zbtb43 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324777
Artikelname: Zbtb43 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324777
Hersteller Artikelnummer: orb324777
Alternativnummer: BYT-ORB324777-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: anti 1700010E06Rik antibody, anti Zfp297b antibody, anti mKIAA0414 antibody
Rabbit polyclonal antibody to Zbtb43
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 57kDa
NCBI: 082223
UniProt: Q9DAI4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: HMKIHTGIKPYECNICAKRFMWRDSFHRHVTSCTKSYEAAKAEQNTTEAN
Target-Kategorie: Zbtb43
WB Suggested Anti-Zbtb43 Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Kidney.