Zbtb43 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324777
| Article Name: |
Zbtb43 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324777 |
| Supplier Catalog Number: |
orb324777 |
| Alternative Catalog Number: |
BYT-ORB324777-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti 1700010E06Rik antibody, anti Zfp297b antibody, anti mKIAA0414 antibody |
| Rabbit polyclonal antibody to Zbtb43 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
57kDa |
| NCBI: |
082223 |
| UniProt: |
Q9DAI4 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: HMKIHTGIKPYECNICAKRFMWRDSFHRHVTSCTKSYEAAKAEQNTTEAN |
| Target: |
Zbtb43 |
![]()
|
WB Suggested Anti-Zbtb43 Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Kidney. |
