SIX4 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: SIX4 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324789
• Hersteller Artikelnummer: orb324789
• Alternativnummer: BYT-ORB324789-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SIX4
• Konjugation: Unconjugated
• Alternative Synonym: Anti-SIX4 antibody, anti AREC3 antibody, anti Homeobox protein SIX4 antibody, anti Sine oculis homeobox homolog 4 antibody, anti SIX homeobox 4 antibody

Produktbeschreibung

Rabbit polyclonal antibody to SIX4

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 83kDa
• NCBI: 059116
• UniProt: Q9UIU6
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: MSSSSPTGQIASAADIKQENGMESASEGQEAHREVAGGAAVGLSPPAPAP
• Target-Kategorie: SIX4

Bilder

WB Suggested Anti-SIX4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Hela cell lysate.