SIX4 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: SIX4 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324789
• Supplier Catalog Number: orb324789
• Alternative Catalog Number: BYT-ORB324789-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SIX4
• Conjugation: Unconjugated
• Alternative Names: Anti-SIX4 antibody, anti AREC3 antibody, anti Homeobox protein SIX4 antibody, anti Sine oculis homeobox homolog 4 antibody, anti SIX homeobox 4 antibody

Product Description

Rabbit polyclonal antibody to SIX4

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 83kDa
• NCBI: 059116
• UniProt: Q9UIU6
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: MSSSSPTGQIASAADIKQENGMESASEGQEAHREVAGGAAVGLSPPAPAP
• Target: SIX4

Images

WB Suggested Anti-SIX4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Hela cell lysate.