Zfp148 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: Zfp148 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324804
• Hersteller Artikelnummer: orb324804
• Alternativnummer: BYT-ORB324804-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Zfp148
• Konjugation: Unconjugated
• Alternative Synonym: anti 2210405J08Rik antibody, anti AI480666 antibody, anti AW045217 antibody, anti BERF-1 antibody, anti BFCOL1 antibody, anti ZBP-89 antibody, anti Znf148 antibody

Produktbeschreibung

Rabbit polyclonal antibody to Zfp148

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 87kDa
• NCBI: 035879
• Pubmed: 40333790
• UniProt: Q548L0
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: MNIDDKLEGLFLKCGGIDEMQSSRAMVVMGGVSGQSAVSGELQESVLQDR
• Target-Kategorie: Zfp148

Bilder

Sample Type: Mouse Heart lysates, Antibody Dilution: 1.0 ug/mL.