Zfp148 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: Zfp148 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324804
• Supplier Catalog Number: orb324804
• Alternative Catalog Number: BYT-ORB324804-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Zfp148
• Conjugation: Unconjugated
• Alternative Names: anti 2210405J08Rik antibody, anti AI480666 antibody, anti AW045217 antibody, anti BERF-1 antibody, anti BFCOL1 antibody, anti ZBP-89 antibody, anti Znf148 antibody

Product Description

Rabbit polyclonal antibody to Zfp148

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 87kDa
• NCBI: 035879
• Pubmed: 40333790
• UniProt: Q548L0
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: MNIDDKLEGLFLKCGGIDEMQSSRAMVVMGGVSGQSAVSGELQESVLQDR
• Target: Zfp148

Images

Sample Type: Mouse Heart lysates, Antibody Dilution: 1.0 ug/mL.