ZNF644 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: ZNF644 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324813
• Hersteller Artikelnummer: orb324813
• Alternativnummer: BYT-ORB324813-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF644
• Konjugation: Unconjugated
• Alternative Synonym: anti BM-005 antibody, anti KIAA1221 antibody, anti MGC60165 antibody, anti MGC70410 antibody, anti Zep-2 antibody, anti NatF antibody, anti MYP21 antibody, anti ZEP-2 antibody

Produktbeschreibung

Rabbit polyclonal antibody to ZNF644

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 149kDa
• NCBI: 958357
• UniProt: Q9H582
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: MDLTMHSALDCKQKKSRSRSGSKKKMLTLPHGADEVYILRCRFCGLVFRG
• Target-Kategorie: ZNF644

Bilder

WB Suggested Anti-ZNF644 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human brain.