ZNF644 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324813
Article Name: ZNF644 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324813
Supplier Catalog Number: orb324813
Alternative Catalog Number: BYT-ORB324813-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF644
Conjugation: Unconjugated
Alternative Names: anti BM-005 antibody, anti KIAA1221 antibody, anti MGC60165 antibody, anti MGC70410 antibody, anti Zep-2 antibody, anti NatF antibody, anti MYP21 antibody, anti ZEP-2 antibody
Rabbit polyclonal antibody to ZNF644
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 149kDa
NCBI: 958357
UniProt: Q9H582
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: MDLTMHSALDCKQKKSRSRSGSKKKMLTLPHGADEVYILRCRFCGLVFRG
Target: ZNF644
WB Suggested Anti-ZNF644 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human brain.