ZNF461 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324826
Artikelname: ZNF461 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324826
Hersteller Artikelnummer: orb324826
Alternativnummer: BYT-ORB324826-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZN461
Konjugation: Unconjugated
Alternative Synonym: anti ZNF461 antibody, anti GIOT1 antibody, anti antibody
Rabbit polyclonal antibody to ZN461
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 47kDa
UniProt: Q8TAF7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: FRLHSHLIQHQRIHTGEKPYECKECGKAFSYHSSFSHHQRIHSGKKPYQC
Target-Kategorie: ZNF461
Sample Type: NCI-H226 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.