ZNF461 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324826
Article Name: ZNF461 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324826
Supplier Catalog Number: orb324826
Alternative Catalog Number: BYT-ORB324826-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZN461
Conjugation: Unconjugated
Alternative Names: anti ZNF461 antibody, anti GIOT1 antibody, anti antibody
Rabbit polyclonal antibody to ZN461
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 47kDa
UniProt: Q8TAF7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: FRLHSHLIQHQRIHTGEKPYECKECGKAFSYHSSFSHHQRIHSGKKPYQC
Target: ZNF461
Sample Type: NCI-H226 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.