EXOSC3 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: EXOSC3 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324838
• Hersteller Artikelnummer: orb324838
• Alternativnummer: BYT-ORB324838-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human EXOSC3
• Konjugation: Unconjugated
• Alternative Synonym: anti CGI-102 antibody, anti MGC15120 antibody, anti MGC723 antibody, anti RP11-3J10.8 antibody, anti RRP40 antibody, anti Rrp40p antibody, anti bA3J10.7 antibody, anti hRrp40p antibody, anti p10 antibody, anti hRrp-40 antibody

Produktbeschreibung

Rabbit polyclonal antibody to EXOSC3

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 17kDa
• NCBI: 001002269
• UniProt: Q9NQT5
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: VIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQAISSRL
• Target-Kategorie: EXOSC3

Bilder

WB Suggested Anti-EXOSC3 Antibody Titration: 0.2-1 ug/mL, Positive Control: Human Placenta.