EXOSC3 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: EXOSC3 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324838
• Supplier Catalog Number: orb324838
• Alternative Catalog Number: BYT-ORB324838-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human EXOSC3
• Conjugation: Unconjugated
• Alternative Names: anti CGI-102 antibody, anti MGC15120 antibody, anti MGC723 antibody, anti RP11-3J10.8 antibody, anti RRP40 antibody, anti Rrp40p antibody, anti bA3J10.7 antibody, anti hRrp40p antibody, anti p10 antibody, anti hRrp-40 antibody

Product Description

Rabbit polyclonal antibody to EXOSC3

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 17kDa
• NCBI: 001002269
• UniProt: Q9NQT5
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: VIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQAISSRL
• Target: EXOSC3

Images

WB Suggested Anti-EXOSC3 Antibody Titration: 0.2-1 ug/mL, Positive Control: Human Placenta.