KYAT3 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: KYAT3 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324841
• Hersteller Artikelnummer: orb324841
• Alternativnummer: BYT-ORB324841-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CCBL2
• Konjugation: Unconjugated
• Alternative Synonym: anti DKFZp547N1117 antibody, anti DKFZp667D0223 antibody, anti KAT3 antibody, anti MGC9398 antibody, anti RBM1 antibody, anti RBMXL1 antibody, anti RP4-531M19.2 antibody, anti KATIII antibody, anti RP11-82K18.3 antibody

Produktbeschreibung

Rabbit polyclonal antibody to CCBL2

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 48kDa
• NCBI: 001008662
• UniProt: A8MY75
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: LSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS
• Target-Kategorie: KYAT3

Bilder

WB Suggested Anti-CCBL2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human brain.