KYAT3 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: KYAT3 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324841
• Supplier Catalog Number: orb324841
• Alternative Catalog Number: BYT-ORB324841-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CCBL2
• Conjugation: Unconjugated
• Alternative Names: anti DKFZp547N1117 antibody, anti DKFZp667D0223 antibody, anti KAT3 antibody, anti MGC9398 antibody, anti RBM1 antibody, anti RBMXL1 antibody, anti RP4-531M19.2 antibody, anti KATIII antibody, anti RP11-82K18.3 antibody

Product Description

Rabbit polyclonal antibody to CCBL2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 48kDa
• NCBI: 001008662
• UniProt: A8MY75
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: LSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS
• Target: KYAT3

Images

WB Suggested Anti-CCBL2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human brain.