KYAT3 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: KYAT3 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324842
• Hersteller Artikelnummer: orb324842
• Alternativnummer: BYT-ORB324842-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RP11-82K18.3
• Konjugation: Unconjugated
• Alternative Synonym: anti RP11-82K18.3 antibody, anti RP4-531M19.2 antibody, anti KAT3 antibody, anti KATIII antibody

Produktbeschreibung

Rabbit polyclonal antibody to CCBL2

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 1.0 mg/ml
• Molekulargewicht: 46kDa
• NCBI: 001008662
• UniProt: Q6YP21
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: SGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLAA
• Target-Kategorie: KYAT3

Bilder

WB Suggested Anti-RP11-82K18.3 Antibody Titration: 2.5 ug/mL, Positive Control: Jurkat cell lysate, CCBL2 is supported by BioGPS gene expression data to be expressed in Jurkat.