KYAT3 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: KYAT3 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324842
• Supplier Catalog Number: orb324842
• Alternative Catalog Number: BYT-ORB324842-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RP11-82K18.3
• Conjugation: Unconjugated
• Alternative Names: anti RP11-82K18.3 antibody, anti RP4-531M19.2 antibody, anti KAT3 antibody, anti KATIII antibody

Product Description

Rabbit polyclonal antibody to CCBL2

Product Properties

• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Molecular Weight: 46kDa
• NCBI: 001008662
• UniProt: Q6YP21
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: SGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLAA
• Target: KYAT3

Images

WB Suggested Anti-RP11-82K18.3 Antibody Titration: 2.5 ug/mL, Positive Control: Jurkat cell lysate, CCBL2 is supported by BioGPS gene expression data to be expressed in Jurkat.