BFSP1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324852
| Artikelname: |
BFSP1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324852 |
| Hersteller Artikelnummer: |
orb324852 |
| Alternativnummer: |
BYT-ORB324852-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human BFSP1 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti CP115 antibody, anti CP94 antibody, anti FILENSIN antibody, anti LIFL-H antibody |
| Rabbit polyclonal antibody to BFSP1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
74kDa |
| NCBI: |
001186 |
| UniProt: |
Q12934 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: QVESNRQRVRDLEAERARLERQGTEAQRALDEFRSKYENECECQLLLKEM |
| Target-Kategorie: |
BFSP1 |
![]()
|
WB Suggested Anti-BFSP1 Antibody Titration: 0.2-1 ug/mL, Positive Control: Hela cell lysate. |
