BFSP1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324852
Article Name: BFSP1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324852
Supplier Catalog Number: orb324852
Alternative Catalog Number: BYT-ORB324852-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BFSP1
Conjugation: Unconjugated
Alternative Names: anti CP115 antibody, anti CP94 antibody, anti FILENSIN antibody, anti LIFL-H antibody
Rabbit polyclonal antibody to BFSP1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 74kDa
NCBI: 001186
UniProt: Q12934
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: QVESNRQRVRDLEAERARLERQGTEAQRALDEFRSKYENECECQLLLKEM
Target: BFSP1
WB Suggested Anti-BFSP1 Antibody Titration: 0.2-1 ug/mL, Positive Control: Hela cell lysate.