SCYE1 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: SCYE1 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324873
• Hersteller Artikelnummer: orb324873
• Alternativnummer: BYT-ORB324873-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SCYE1
• Konjugation: Unconjugated
• Alternative Synonym: anti p43 antibody, anti HLD3 antibody, anti EMAP2 antibody, anti SCYE1 antibody, anti EMAPII antibody

Produktbeschreibung

Rabbit polyclonal antibody to AIMP1

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 34kDa
• NCBI: 004748
• UniProt: Q12904
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: LLKEKAILQATLREEKKLRVENAKLKKEIEELKQELIQAEIQNGVKQIPF
• Target-Kategorie: AIMP1

Bilder

WB Suggested Anti-SCYE1 Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate, AIMP1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.