SCYE1 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324873
Artikelname: SCYE1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324873
Hersteller Artikelnummer: orb324873
Alternativnummer: BYT-ORB324873-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SCYE1
Konjugation: Unconjugated
Alternative Synonym: anti p43 antibody, anti HLD3 antibody, anti EMAP2 antibody, anti SCYE1 antibody, anti EMAPII antibody
Rabbit polyclonal antibody to AIMP1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 34kDa
NCBI: 004748
UniProt: Q12904
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: LLKEKAILQATLREEKKLRVENAKLKKEIEELKQELIQAEIQNGVKQIPF
Target-Kategorie: AIMP1
WB Suggested Anti-SCYE1 Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate, AIMP1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.