SCYE1 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: SCYE1 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324873
• Supplier Catalog Number: orb324873
• Alternative Catalog Number: BYT-ORB324873-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SCYE1
• Conjugation: Unconjugated
• Alternative Names: anti p43 antibody, anti HLD3 antibody, anti EMAP2 antibody, anti SCYE1 antibody, anti EMAPII antibody

Product Description

Rabbit polyclonal antibody to AIMP1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 34kDa
• NCBI: 004748
• UniProt: Q12904
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: LLKEKAILQATLREEKKLRVENAKLKKEIEELKQELIQAEIQNGVKQIPF
• Target: AIMP1

Images

WB Suggested Anti-SCYE1 Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate, AIMP1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.