PIGK Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324878
Artikelname: PIGK Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324878
Hersteller Artikelnummer: orb324878
Alternativnummer: BYT-ORB324878-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PIGK
Konjugation: Unconjugated
Alternative Synonym: anti GPI8 antibody, anti MGC22559 antibody
Rabbit polyclonal antibody to PIGK
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 43kDa
NCBI: 005473
UniProt: Q92643
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: SVYRSVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDD
Target-Kategorie: PIGK
WB Suggested Anti-PIGK Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate.