PIGK Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324878
Article Name: PIGK Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324878
Supplier Catalog Number: orb324878
Alternative Catalog Number: BYT-ORB324878-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PIGK
Conjugation: Unconjugated
Alternative Names: anti GPI8 antibody, anti MGC22559 antibody
Rabbit polyclonal antibody to PIGK
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 43kDa
NCBI: 005473
UniProt: Q92643
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: SVYRSVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDD
Target: PIGK
WB Suggested Anti-PIGK Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate.