PIGK Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324878
| Article Name: |
PIGK Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324878 |
| Supplier Catalog Number: |
orb324878 |
| Alternative Catalog Number: |
BYT-ORB324878-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human PIGK |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti GPI8 antibody, anti MGC22559 antibody |
| Rabbit polyclonal antibody to PIGK |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
43kDa |
| NCBI: |
005473 |
| UniProt: |
Q92643 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: SVYRSVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDD |
| Target: |
PIGK |
|
WB Suggested Anti-PIGK Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate. |