HNRPM Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: HNRPM Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324880
• Hersteller Artikelnummer: orb324880
• Alternativnummer: BYT-ORB324880-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPM
• Konjugation: Unconjugated
• Alternative Synonym: anti DKFZp547H118 antibody, anti HNRNPM antibody, anti HNRNPM4 antibody, anti HNRPM4 antibody, anti HTGR1 antibody, anti NAGR1 antibody, anti CEAR antibody, anti HNRPM antibody, anti hnRNP M antibody

Produktbeschreibung

Rabbit polyclonal antibody to HNRNPM

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 73kDa
• NCBI: 112480
• UniProt: P52272
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: ATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFE
• Target-Kategorie: HNRNPM

Bilder

WB Suggested Anti-HNRPM Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate, HNRNPM is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.