HNRPM Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: HNRPM Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324880
• Supplier Catalog Number: orb324880
• Alternative Catalog Number: BYT-ORB324880-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPM
• Conjugation: Unconjugated
• Alternative Names: anti DKFZp547H118 antibody, anti HNRNPM antibody, anti HNRNPM4 antibody, anti HNRPM4 antibody, anti HTGR1 antibody, anti NAGR1 antibody, anti CEAR antibody, anti HNRPM antibody, anti hnRNP M antibody

Product Description

Rabbit polyclonal antibody to HNRNPM

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 73kDa
• NCBI: 112480
• UniProt: P52272
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: ATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFE
• Target: HNRNPM

Images

WB Suggested Anti-HNRPM Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate, HNRNPM is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.