RNASEN Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324893
Artikelname: RNASEN Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324893
Hersteller Artikelnummer: orb324893
Alternativnummer: BYT-ORB324893-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RNASEN
Konjugation: Unconjugated
Alternative Synonym: anti DROSHA antibody, anti ETOHI2 antibody, anti HSA242976 antibody, anti RANSE3L antibody, anti RN3 antibody, anti RNASE3L antibody, anti RNASEN antibody
Rabbit polyclonal antibody to DROSHA
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 159kDa
NCBI: 037367
UniProt: Q9NRR4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: AAMDALEKYNFPQMAHQKRFIERKYRQELKEMRWEREHQEREPDETEDIK
Target-Kategorie: DROSHA
WB Suggested Anti-RNASEN Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human Spleen.