RNASEN Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324893
Article Name: RNASEN Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324893
Supplier Catalog Number: orb324893
Alternative Catalog Number: BYT-ORB324893-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RNASEN
Conjugation: Unconjugated
Alternative Names: anti DROSHA antibody, anti ETOHI2 antibody, anti HSA242976 antibody, anti RANSE3L antibody, anti RN3 antibody, anti RNASE3L antibody, anti RNASEN antibody
Rabbit polyclonal antibody to DROSHA
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 159kDa
NCBI: 037367
UniProt: Q9NRR4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: AAMDALEKYNFPQMAHQKRFIERKYRQELKEMRWEREHQEREPDETEDIK
Target: DROSHA
WB Suggested Anti-RNASEN Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human Spleen.