RBM9 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: RBM9 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324895
• Hersteller Artikelnummer: orb324895
• Alternativnummer: BYT-ORB324895-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RBM9
• Konjugation: Unconjugated
• Alternative Synonym: anti Fox-2 antibody, anti HNRBP2 antibody, anti HRNBP2 antibody, anti RTA antibody, anti dJ106I20.3 antibody, anti fxh antibody, anti FOX2 antibody, anti RBM9 antibody

Produktbeschreibung

Rabbit polyclonal antibody to RBFOX2

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 39kDa
• NCBI: 055124
• UniProt: O43251
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: PPTAIPAYPGVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPT
• Target-Kategorie: RBFOX2

Bilder

WB Suggested Anti-RBM9 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: NCI-H226 cell lysate, RBFOX2 is supported by BioGPS gene expression data to be expressed in NCIH226.