RBM9 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: RBM9 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324895
• Supplier Catalog Number: orb324895
• Alternative Catalog Number: BYT-ORB324895-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RBM9
• Conjugation: Unconjugated
• Alternative Names: anti Fox-2 antibody, anti HNRBP2 antibody, anti HRNBP2 antibody, anti RTA antibody, anti dJ106I20.3 antibody, anti fxh antibody, anti FOX2 antibody, anti RBM9 antibody

Product Description

Rabbit polyclonal antibody to RBFOX2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 39kDa
• NCBI: 055124
• UniProt: O43251
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: PPTAIPAYPGVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPT
• Target: RBFOX2

Images

WB Suggested Anti-RBM9 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: NCI-H226 cell lysate, RBFOX2 is supported by BioGPS gene expression data to be expressed in NCIH226.