TMEM63A Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: TMEM63A Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324899
• Hersteller Artikelnummer: orb324899
• Alternativnummer: BYT-ORB324899-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: anti KIAA0489 antibody, anti KIAA0792 antibody

Produktbeschreibung

Rabbit polyclonal antibody to TMEM63A

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 92kDa
• NCBI: 055513
• UniProt: O94886
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: FLVLLLTILVCLAHTCFGCFKHLSPLNYKTEEPASDKGSEAEAHMPPPFT
• Target-Kategorie: TMEM63A

Bilder

WB Suggested Anti-TMEM63A Antibody, Titration: 1.0 ug/mL, Positive Control: PANC1 Whole Cell, There is BioGPS gene expression data showing that TMEM63A is expressed in PANC1.