TMEM63A Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: TMEM63A Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324899
• Supplier Catalog Number: orb324899
• Alternative Catalog Number: BYT-ORB324899-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: anti KIAA0489 antibody, anti KIAA0792 antibody

Product Description

Rabbit polyclonal antibody to TMEM63A

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 92kDa
• NCBI: 055513
• UniProt: O94886
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: FLVLLLTILVCLAHTCFGCFKHLSPLNYKTEEPASDKGSEAEAHMPPPFT
• Target: TMEM63A

Images

WB Suggested Anti-TMEM63A Antibody, Titration: 1.0 ug/mL, Positive Control: PANC1 Whole Cell, There is BioGPS gene expression data showing that TMEM63A is expressed in PANC1.