CTA-126B4.3 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324902
| Artikelname: |
CTA-126B4.3 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324902 |
| Hersteller Artikelnummer: |
orb324902 |
| Alternativnummer: |
BYT-ORB324902-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human CTA-126B4.3 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti BK126B4.3 antibody, anti CGI-96 antibody, anti MGC150422 antibody, anti MGC150423 antibody, anti CTA-126B4.3 antibody |
| Rabbit polyclonal antibody to RRP7A |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
32kDa |
| NCBI: |
056518 |
| UniProt: |
Q9Y3A4 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: NVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVP |
| Target-Kategorie: |
RRP7A |
![]()
|
WB Suggested Anti-CTA-126B4.3 Antibody Titration: 0.2-1 ug/mL, Positive Control: MCF7 cell lysate. |
