CTA-126B4.3 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324902
| Article Name: |
CTA-126B4.3 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324902 |
| Supplier Catalog Number: |
orb324902 |
| Alternative Catalog Number: |
BYT-ORB324902-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human CTA-126B4.3 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti BK126B4.3 antibody, anti CGI-96 antibody, anti MGC150422 antibody, anti MGC150423 antibody, anti CTA-126B4.3 antibody |
| Rabbit polyclonal antibody to RRP7A |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
32kDa |
| NCBI: |
056518 |
| UniProt: |
Q9Y3A4 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: NVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVP |
| Target: |
RRP7A |
![]()
|
WB Suggested Anti-CTA-126B4.3 Antibody Titration: 0.2-1 ug/mL, Positive Control: MCF7 cell lysate. |
