TRSPAP1 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: TRSPAP1 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324907
• Hersteller Artikelnummer: orb324907
• Alternativnummer: BYT-ORB324907-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRSPAP1
• Konjugation: Unconjugated
• Alternative Synonym: anti FLJ20503 antibody, anti PRO1902 antibody, anti RP4-669K10.4 antibody, anti SECP43 antibody, anti TRSPAP1 antibody

Produktbeschreibung

Rabbit polyclonal antibody to TRNAU1AP

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 1.0 mg/ml
• Molekulargewicht: 32kDa
• NCBI: 060316
• UniProt: Q9NX07
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: KPVEYSQMYSYSYNQYYQQYQNYYAQWGYDQNTGSYSYSYPQYGYTQSTM
• Target-Kategorie: TRNAU1AP

Bilder

WB Suggested Anti-TRSPAP1 Antibody Titration: 1.25 ug/mL, Positive Control: Jurkat cell lysate, TRNAU1AP is supported by BioGPS gene expression data to be expressed in Jurkat.