TRSPAP1 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: TRSPAP1 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324907
• Supplier Catalog Number: orb324907
• Alternative Catalog Number: BYT-ORB324907-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRSPAP1
• Conjugation: Unconjugated
• Alternative Names: anti FLJ20503 antibody, anti PRO1902 antibody, anti RP4-669K10.4 antibody, anti SECP43 antibody, anti TRSPAP1 antibody

Product Description

Rabbit polyclonal antibody to TRNAU1AP

Product Properties

• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Molecular Weight: 32kDa
• NCBI: 060316
• UniProt: Q9NX07
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: KPVEYSQMYSYSYNQYYQQYQNYYAQWGYDQNTGSYSYSYPQYGYTQSTM
• Target: TRNAU1AP

Images

WB Suggested Anti-TRSPAP1 Antibody Titration: 1.25 ug/mL, Positive Control: Jurkat cell lysate, TRNAU1AP is supported by BioGPS gene expression data to be expressed in Jurkat.