TRSPAP1 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324908
Artikelname: TRSPAP1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324908
Hersteller Artikelnummer: orb324908
Alternativnummer: BYT-ORB324908-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRSPAP1
Konjugation: Unconjugated
Alternative Synonym: anti FLJ20503 antibody, anti PRO1902 antibody, anti RP4-669K10.4 antibody, anti SECP43 antibody, anti TRSPAP1 antibody
Rabbit polyclonal antibody to TRNAU1AP
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 32kDa
NCBI: 060316
UniProt: Q9NX07
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: PGATPAKRFKLNYATYGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVY
Target-Kategorie: TRNAU1AP
WB Suggested Anti-TRSPAP1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human Intestine.