TRSPAP1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324908
Article Name: TRSPAP1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324908
Supplier Catalog Number: orb324908
Alternative Catalog Number: BYT-ORB324908-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRSPAP1
Conjugation: Unconjugated
Alternative Names: anti FLJ20503 antibody, anti PRO1902 antibody, anti RP4-669K10.4 antibody, anti SECP43 antibody, anti TRSPAP1 antibody
Rabbit polyclonal antibody to TRNAU1AP
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 32kDa
NCBI: 060316
UniProt: Q9NX07
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: PGATPAKRFKLNYATYGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVY
Target: TRNAU1AP
WB Suggested Anti-TRSPAP1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human Intestine.