UPF3A Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324921
| Artikelname: |
UPF3A Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324921 |
| Hersteller Artikelnummer: |
orb324921 |
| Alternativnummer: |
BYT-ORB324921-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human UPF3A |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti HUPF3A antibody, anti RENT3A antibody, anti UPF3 antibody |
| Rabbit polyclonal antibody to UPF3A |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
55kDa |
| NCBI: |
075387 |
| UniProt: |
Q9H1J1 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: QRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKKGSQDSGAPG |
| Target-Kategorie: |
UPF3A |
![]()
|
WB Suggested Anti-UPF3A Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human kidney. |
