UPF3A Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324921
Article Name: UPF3A Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324921
Supplier Catalog Number: orb324921
Alternative Catalog Number: BYT-ORB324921-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UPF3A
Conjugation: Unconjugated
Alternative Names: anti HUPF3A antibody, anti RENT3A antibody, anti UPF3 antibody
Rabbit polyclonal antibody to UPF3A
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 55kDa
NCBI: 075387
UniProt: Q9H1J1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: QRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKKGSQDSGAPG
Target: UPF3A
WB Suggested Anti-UPF3A Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human kidney.