FAM121B Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324923
Artikelname: FAM121B Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324923
Hersteller Artikelnummer: orb324923
Alternativnummer: BYT-ORB324923-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM121B
Konjugation: Unconjugated
Alternative Synonym: anti My025 antibody, anti FAM121B antibody
Rabbit polyclonal antibody to APOO
Klonalität: Polyclonal
Konzentration: 1.0 mg/ml
Molekulargewicht: 22kDa
NCBI: 077027
UniProt: Q9BUR5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: PASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQL
Target-Kategorie: APOO
WB Suggested Anti-FAM121B Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.