FAM121B Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324923
| Article Name: |
FAM121B Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324923 |
| Supplier Catalog Number: |
orb324923 |
| Alternative Catalog Number: |
BYT-ORB324923-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human FAM121B |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti My025 antibody, anti FAM121B antibody |
| Rabbit polyclonal antibody to APOO |
| Clonality: |
Polyclonal |
| Concentration: |
1.0 mg/ml |
| Molecular Weight: |
22kDa |
| NCBI: |
077027 |
| UniProt: |
Q9BUR5 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: PASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQL |
| Target: |
APOO |
![]()
|
WB Suggested Anti-FAM121B Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. |
